University | Singapore University of Social Science (SUSS) |
Subject | BME355 Genomic Sequence Analysis Assignment |
BME355 Genomic Sequence Analysis Assignment, SUSS, Singapore: Using the OMIM database information for Type 2 Diabetes Mellitus (T2D)
Question 1
Using the OMIM database information for Type 2 Diabetes Mellitus (T2D)
(https://omim.org/entry/125853), solve the following tasks.
Question 1a
Extract out the genes associated with T2D and use the list as input in the online tool DAVID (Database for Annotation, Visualization, and Integrated Discovery).
Question 1b
Create a functional annotation clustering of the gene list and paste screenshots of the results from GOTERM_BP/CC/MF_DIRECT and KEGG_PATHWAY. Report the clusters having enrichment scores above 1.
Question 1c
Appraise the results obtained and discuss the relevancy of the findings to the gene list.
Question 2
Using the NCBI database, explore the gene with Gene ID: 79923.
Question 2a
State the gene symbol given to this ID and the full official name of the gene.
Question 2b
Discuss the function of this gene in your own words.
Question 2c
Determine the mRNA transcripts and protein isoforms of this gene.
Question 2d
Describe FIVE (5) pathways in which the corresponding gene is involved in.
Question 2e
Identify the conserved domains in the protein isoforms of this gene.
Hire a Professional Essay & Assignment Writer for completing your Academic Assessments
Question 3
Demonstrate your understanding of molecular genetics and computational biology by critically evaluating the following statements.
Question 3a
Protein alignments are often more informative than DNA alignments.
Question 3b
When comparing two sequences, it is necessary to repeat the search using different scoring matrices.
Question 3c
The statistical significance of a BLAST result can be assessed through S-values.
Question 3d
Position-specific iterated BLAST (PSI-Blast) is often less sensitive than a regular Blast search in finding distantly related protein sequences.
Question 3e
Benchmarking is an important approach to compare different software and determine their accuracy.
Question 4
With the help of an alignment tool you have learned, examine the human sequence given below, and furnish answers to the following questions:
>SEQ
MCGATSFLHECTRLILVTTQNAEFLQKGLQVHTCFGVYPHASVWHDCASQK
KGCAVYLHVSVEFNKLIPE
NGFIKFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTH
GTLESVNGPKAGSRGLTS
LADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLE
EYKNYLDAANMSMRVRR
HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQ
YFYETKCNPMGYTKEGCRG
IDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Question 4a
Give the name and accession number of the sequence.
Question 4b
Appraise the function of the corresponding gene.
Question 4c
Describe FIVE (5) pathways which the genic form is involved in.
Question 4d
List the Gene Ontology functions and processes.
Question 5
Using the resulting information from the above-mentioned sequence in
Question 4,
extract out the sequences from Homo sapiens and organisms such as Pan troglodytes, Canis lupus familiaris, Bos Taurus, and Mus musculus
Question 5a
Paste the sequences in a fast format.
Question 5b
Create a multiple sequence alignment using any multiple sequence alignment tool. Paste the alignment and the phylogenetic tree.
Question 5c
Evaluate the alignment and the phylogenetic tree derived in Question 5b.
Buy Custom Answer of This Assessment & Raise Your Grades
Are you a student at the Singapore University of Social Science (SUSS) struggling with your BME355 Genomic Sequence Analysis Assignment on Type 2 Diabetes Mellitus (T2D)? Look no further! At Assignment Helper SG, we offer a top-notch Report Writing Service for Singapore students. Our experts are here to assist you with your individual assignments, ensuring you excel in your coursework. Don't stress over your assignment; pay our experts for the help you need and achieve academic success.
- Business Accounting & Finance – (VM) – A3 Assignment, UOM, Singapore
- HRM3010S: Managing People At Work, Assignment, UCD, Singapore
- HFS351: Safety Management and Audit, End-of-Course Assessment, SUSS, Singapore
- HFSY217: Emergency Preparedness and Response Planning, TMA (Tutor-Marked Assignment), SUSS
- CMM315: TMA (Tutor-Marked Assignment) – Peacebuilding and Security, SUSS, Singapore
- Harley Davidson utilized different entry mode strategies in pursuit of internationalization: Sustainable, Assignment, UoN, Singapore
- Nursing Patients With Chronic Illness, Assignment 3, LTU, Singapore: Jason Bundhoo is a 42-year-old car driver from Triolet
- DSM: R for Data Science, Coursework 2, UOL, Singapore: In this coursework assignment you should return to this dataset and perform an appropriate investigation into building a statistical model
- DSM120: Financial Data Modelling, Coursework 1, UOL, Singapore
- Data Science Final Project, Coursework 1, UOL, Singapore: Your first formal coursework submission is your full project proposal, This sets out very clearly what your Data Science Project will be, and also how you will conduct the project
UP TO 15 % DISCOUNT